SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K439 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K439
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-35
Family SCAN domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000163
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 516-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000021
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000235
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8K439
Sequence length 680
Comment (tr|Q8K439|Q8K439_MOUSE) Kruppel-associated box-zinc finger protein NT2 {ECO:0000313|EMBL:AAM93158.1} OX=10090 OS=Mus musculus (Mouse). GN=Zfp263 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTMAAGPSSQEPEGLLIVKLEEDCAWSHEVPPPEPEPSPEASHLRFRRFRFQDAPGPREA
LSRLQELCRGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELRPESGEEAVILVER
MQKELGKLRQQFTNQGRGAEVLLEEPLPLETAGESPSFKLEPMEIERSPGPRLQELLDPS
PQRDSQAVKERALSAPWLSLFPPEGNVEDKDMTGTQLPESLEDMAMYISQEWDHQDPSKR
ALSRYMVQDSYENSGTLESSIPSQEVSSTHVEQGEKLWDSSVQTCKEGMNPRNPVPGVEK
FENQERNVESVSPESTHPPVLLPGQARREVPWSPEQGRLDDREGHWECPPEDKIEESLVG
TPSCKGLVQAKEQPKKLHLCALCGKNFSNNSNLIRHQRIHAAEKLCMDVECGEVFGGHPH
FLSLHRTHIGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPFQCNACGKSFSCNSNLNRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYRCSECGKSFSRSSHLVIHERTH
EKERLDPFPECGQGMNDSAPFLTNHRVEKKLFECSTCGKSFRQGMHLTRHQRTHTGEKPY
KCILCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSE
CGESFSRSSRLTSHQRTHTG
Download sequence
Identical sequences Q8K439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]