SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K572 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8K572
Domain Number - Region: 16-110
Classification Level Classification E-value
Superfamily DNA clamp 0.0118
Family DNA polymerase processivity factor 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8K572
Sequence length 276
Comment (sp|Q8K572|HUS1B_MOUSE) Checkpoint protein HUS1B KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hus1b; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQLWGEMRRDV
FHHFCMEGASQEFNEICLELMSEHLARAVKNAGNASSLKLQLTNKQRPCLTLVVELASCP
GHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVE
ANLNGRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRDPETMVQVRVDNRKLLQCFDG
HQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS
Download sequence
Identical sequences Q059L7 Q8K572
ENSMUSP00000100007 NP_694712.1.92730 10090.ENSMUSP00000100007 ENSMUSP00000100007 ENSMUSP00000100007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]