SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K5A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K5A9
Domain Number 1 Region: 133-219
Classification Level Classification E-value
Superfamily DEATH domain 3.83e-18
Family DEATH domain, DD 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8K5A9
Sequence length 228
Comment (sp|Q8K5A9|NRADD_RAT) P75-like apoptosis-inducing death domain protein KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Nradd; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MLHNVSKGVVYSDTALKGQDGDREGMWVGAGGALAPNTSSLFPPEPPGASSNIIPVYCAL
LATVVLGLLAYVAFKCWRSRKQRQQLAKARTVELGDPDRDQRHGDSSVFVDSPHGLEPCI
PSQGPHADLGCRLYLHIPQQQQEEVQRLLILGEPAKGWQGLAGQLGYQAEAVETMACDQD
PAYALLRDWAAQEGSGATLRVLEDALTAIGREDVVQVLSSPAEGCSVV
Download sequence
Identical sequences Q8K5A9
ENSRNOP00000028416 ENSRNOP00000028416 10116.ENSRNOP00000028416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]