SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8L6B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8L6B6
Domain Number 1 Region: 4-164
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.15e-35
Family PAPS reductase-like 0.0033
Further Details:      
 
Domain Number 2 Region: 229-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.32e-17
Family PDI-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8L6B6
Sequence length 329
Comment (tr|Q8L6B6|Q8L6B6_SOLTU) APS reductase {ECO:0000313|EMBL:CAD44841.1} OX=4113 OS=Solanum tuberosum (Potato). GN=apsr1 OC=Solaneae; Solanum.
Sequence
SAAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYQLFDTVEKHYGIRIEYMFPDSVEVQA
LVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPIVQVDP
SFEGLDGGAGSLVKWNPVANVDGKDIWNFLRAMNVPVNSLHSQGYVSIGCEPCTRPVLPG
QHEREGRWWWEDAKAKECGLHKGNIKDESVDGAVQTNGTATIADIFDTKDIVTLSKPGVE
NLLKLEDRREPWLVVLYAPWCQFCQAMEGSYVELAEKLAGSGVKVGKSRADGDQKAFAQQ
ELQLGSFPTVLFFPKHSSKAIKYPSEHRD
Download sequence
Identical sequences Q8L6B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]