SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8MWQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8MWQ3
Domain Number 1 Region: 1975-2323
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-79
Family Duffy binding domain 0.0000674
Further Details:      
 
Domain Number 2 Region: 19-394
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-78
Family Duffy binding domain 0.0000922
Further Details:      
 
Domain Number 3 Region: 709-1073,1123-1129
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-72
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 1150-1339,1373-1486,1517-1535
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-67
Family Duffy binding domain 0.0000808
Further Details:      
 
Domain Number 5 Region: 2432-2744,2774-2793
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-65
Family Duffy binding domain 0.000099
Further Details:      
 
Domain Number 6 Region: 2794-3112
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-53
Family Duffy binding domain 0.00029
Further Details:      
 
Domain Number 7 Region: 1564-1892
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-52
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 8 Region: 385-594
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-32
Family Duffy binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8MWQ3
Sequence length 3207
Comment (tr|Q8MWQ3|Q8MWQ3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AAM55194.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
HTNLRYDDVNLRHPCHGREQNRFDEDEESECGNKIRNYKRENDAIACAPPRRRHMCDKNL
EALNDINTQNIHDLLGNVLVTAKYEGESIVNNHPHKGTSDVCTALARSFADIGDIIRGID
MFKPNVHDKVEKGLREVFKKIHDGMEGEVKNYYNPDGSGNYYKLREAWWNVNRNKVWEAI
TCGALPKSAYFMQSEDNKQLFSYPKCGHNNKDDPLTNLDYVPQYLRWFDEWGEEFCRKRN
IKLKKVKDSCRNYKERLYCSHNGYDCTTTIWRKGILHLDNKCTDCSTKCKVFEVWLGNQQ
EAFKKQKEKYEKEMNGKTSEHDSTNNNINNKYYKDFYKFLEKNDYKTVHGFINLLNKGRY
CKETLPGEEVMDFTKTGDRETFYRSQYCQVCPDCGVKYDGTQCTHKSDNDSECVNNEDYK
LPWGVKPTNITVLYSGNDQGDITQKLEDFCNSSTNYKDKNNQKWECYYKDENINRCKLEQ
NTEINKDNPKITSFHNFFELWVTYLLRDTIKWNDKLKTCINNTTTHCIDECKRNCLCFDR
WVKQKEEEWNSIKKLFTKKNNVPQPYYTNINNLFEGYFFKVMDKLDKNEAKWKELMENIK
KKKSEFSNLENNRDYLENAIELLLDHLKETATICKDNNTNEACETSHNATTNPCVKPREG
TQPTKNIKEIAQYFKRSAYEEARTRGLHKLKGKAHEGLYKRGGRRKDFKDNLCRIMIKHS
NRKLGFSNGPCDGKGTGDGIQTRFVVGTEWETDPEHMRKDHEDVIMPPRRRHICTSNLEH
LQTDGHPLNGNIVDDLVNNSFLGDVLLSAKYEANKIIRMHKEKNNLKFPKEVTDPKHQAT
ICRAIRYSFADIGDIIRGRDLWERNGDMVKLQGHLETVFGNIYKSLKGKGNDKYNDDAPK
YLKLREDWWEANRAKVWEAMKCDIKYLKDKSRPQSTQSSYCGYSDHTPLDDYIPQKLRWM
TEWAEWYCKVQKKEYDKLKEKCKECKDKYNGQGCTKESGTCCTKCTDACNEYNDIIGLWK
EQWNIISDKYKELHEQAQMSVSNSGIEASSTAKNHIDRNVIEFLSELYQQDGGKSNKSGT
SDQSTVIGTNTRYENVGAYLHDTGNFDDCQLQNEFCDEKSDGKDKEKYAFRDTPNDHDVA
CACNERDKIQPPKEKKKEACAIVGELLKGNNGTTKVGECNVKTEGEYPEWECEKKIQNIH
KGACMPPRRHKLCVHFLKELKVETDEKLREAFIQCSAAETFLLWKKYKEDNNGGEDLQNQ
LESRIIPDDFKRQMFYTFGDYRDLCLGKDIGSDVGNVNQKINSALKKIVQSDEDKRKNWW
NGIKEDVWKGMVCGLSHDVSGNHKEIVRKKIMEDPQNNKYQYNSVKFTDEPSGTKLSEFA
KVPQFLRWLTEWYDDYCYTRQKYLKEAESTCKSNDQLKCDTECNKKCEDYEKYMKKKKEW
ILQDKYYKDERDKKRFNRQHIGVMVKDYTGTNATDYLKRKFTASCGDKPGGSSVVQRNIQ
MLEKQAYYDADKHCGCTKFIENDDKYTNISSKDNCKGLVKEANTGAIKWQNKGPNNYNNL
KKLTEEVFFPSRRLRICFHALDGNYTDPEVKDENGLRKRLMELAATEGYNLGQYYKNKEE
QKNNADNYSYEVGPCSAMKYSFYDLRDIILGYDNLEEDKQDIEKNMKKIFSKNRTSVVKE
SDSSTGFPGSTARKYFWNENKECVWNAMKCGYKRGRDDGNSGNSARSDEDLKKCGSVPSD
DDYPMGKNRDQGTAYQFLRWFAEWGEDFCLHKDKHYKELQDKCPTDTCDNNGKQQQCKEQ
CDKYQEFINDWRTQYEKQSKKYGEDKGGTKYNNHPVAKDAKDAFEYLNIQLQKSCNRGTC
ADCMNKKLTSNGNNMPASLDNEPKEVKGKCNCQVPPGPPRASLTAKATTSKKEEKTASST
KPSKKVGKPTTETPSRSRTRTRRSTQQTRTRTVREAPQALKRTVREAPQALTRTSASTST
TTPPDVCTIVETVLSKKPDSKGGIESCYPKTNGPYPKWDCNPRKFKKNENGACMPPRRKK
LCINNLQYLNNKTETKNENDIKEAFFKCTAIETHFLWKRYKGNNDEVDEKLKYGDIPKDF
IRIMFYTFGDYRDIFFGTDICKDTNIETISKNVQKLLKKKKDNILKTMDKIKRYYWEQYG
PDIWKGMLYGLTYHLKDEGKNRIPEASKYQYNKLKPDLEEFAKRPQFLRWFTEWAEEFCN
KRKKELEILKEKCPDYTCSVDSTKHECEDSCKKYQTFIKQWKTQYEKQREKFKNDKDTDK
YKDYPSIESYIDNATDAHEYLHRQLKELCGNNDCSCMEKPSSQLPKTKSTSEPPNSNDMP
ASLDEVPEGYENKCDCKLQKMEKPDPSLNCIDKSAFQLYAKAKNDLHGMKDELKGKNPKA
VYEEKTNGTNGINIICKINEKISKQKNVCINNENPFDDIDKWDCKERSRTLAIENICIPP
RRKYMCTNPLENLEGKKSISEALFRKVLRTAAYEGKHIKDSWDKKTKPKKRNQICDAIRY
SFADLGDIIRGTDTYKGPNGANGVETKLKAVFQLIYTNFISSSDMVVRKYPNIQSFRSAW
WDANREYVWKAMTCDAPEDAMLFRKLENEEIPNLILSQHKCGYNDHPPVDDYIPQRLRWM
KEWGEYVCKILNEKINNMKNDCDQCKLNGKKCSDDDDGNKCTNCKEKCKEYTKLIHNLKS
QFNIQKQKYNELYTKIQNNRRGFTNDNDKNAIEFFEKVKMINKCDVGTPDKYLDKAIHCI
HYSFTENENENENKNKPYAFNNHPEKYKSHCSCTITHHPLDKCPFNDKTNEYCKTIRHIN
PCIRRYFDNNLETWTGFFVDNISHKNKGVLVPPRRRHLCTTKLTGNRYRTNEKDNLKQNL
IDSAFSHGILLGKTFNDYTNQGLESMKYSFADYADIIKGTDMIGGSNIDDFNNDLKQMFP
ENSSENIKETTISRKHWWEENKTHVWNAMLLGYQKGKKNNGEMDKNWCNVPTEDGTDQFL
RWLIEWAIQACKEKKHVRDSLKTKCRCSEEDNFEASELLRQPGCQNDIRKYISLNILIKN
SMENLNIKYKQLKDQPSGNIDNKPSEENVQSYIKSKDSQCALELNDINEIVTGTKNNELI
EVLKKLYPGSCFVEDKAHKNHVVHENKKEEAKVIFPNEFYYFSPYIKFLNLGSLLSTYRV
EKYDPKNDILKSSISVVIVSALGLIAL
Download sequence
Identical sequences Q8MWQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]