SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8MXE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8MXE5
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.00073
Further Details:      
 
Domain Number 2 Region: 72-230
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.62e-22
Family Nuclear receptor ligand-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8MXE5
Sequence length 242
Comment (tr|Q8MXE5|Q8MXE5_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD72240.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_R11E3.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRFNPCDVCLSPGNGKHFGVDACRGCTAFFRRTIVNKRNYSCSEDDTCEIEKSEGLLCKK
CRFEKCLKVGMKKESIQKHRDIYGRRNPENRALIISPSTSQLQVTIPITLLSSVKRNYAE
LENVREIVHRMDGFSMFLKPAPRGQTYKETYRLLLREFYLVSDWVSNCFPLFKELPNSQK
DILLRNFYLTFYNLEAGFFACQHNKIDVWFLPNGNFIDCQNLEAFYYDPHNQQPMTSADA
AR
Download sequence
Identical sequences Q8MXE5
R11E3.5b NP_741385.1.50509 R11E3.5b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]