SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8N461 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N461
Domain Number 1 Region: 206-464
Classification Level Classification E-value
Superfamily RNI-like 5.1e-45
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 
Domain Number 2 Region: 101-182
Classification Level Classification E-value
Superfamily F-box domain 0.00000000406
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N461
Sequence length 479
Comment (sp|Q8N461|FXL16_HUMAN) F-box and leucine-rich repeat protein 16 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FBXL16; OC=Catarrhini; Hominidae; Homo.
Sequence
MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSL
AAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQV
CKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLD
ICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSL
SARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLR
LLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRIT
DMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Download sequence
Identical sequences Q8N461
ENSP00000318674 ENSP00000380746 gi|289666746|ref|NP_699181.2| ENSP00000318674 ENSP00000380746 ENSP00000318674 9606.ENSP00000318674 NP_699181.2.87134 NP_699181.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]