SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8N485 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8N485
Domain Number - Region: 20-102
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00147
Family Double-stranded RNA-binding domain (dsRBD) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8N485
Sequence length 282
Comment (sp|Q8N485|LIX1_HUMAN) Protein limb expression 1 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LIX1; OC=Catarrhini; Hominidae; Homo.
Sequence
MDRTLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLP
APGPPFVSYVTLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
VQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALR
ETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKERDSPGIVSQELRMALRQLEEARKAGQ
ELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCGYH
Download sequence
Identical sequences Q8N485
9606.ENSP00000274382 gi|167466286|ref|NP_694966.3| ENSP00000274382 NP_694966.3.87134 NP_694966.3.92137 ENSP00000274382 ENSP00000274382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]