SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8N6T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N6T3
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.06e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N6T3
Sequence length 406
Comment (sp|Q8N6T3|ARFG1_HUMAN) ARF1-directed GTPase-activating protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARFGAP1; OC=Catarrhini; Hominidae; Homo.
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
Download sequence
Identical sequences Q8N6T3
ENSP00000359306 NP_060679.1.87134 NP_060679.1.92137 gi|8922652|ref|NP_060679.1| ENSP00000359306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]