SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8N7C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N7C0
Domain Number 1 Region: 24-225
Classification Level Classification E-value
Superfamily L domain-like 1.6e-35
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N7C0
Sequence length 313
Comment (sp|Q8N7C0|LRC52_HUMAN) BK channel auxiliary gamma subunit LRRC52 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LRRC52; OC=Catarrhini; Hominidae; Homo.
Sequence
MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
NENRITSLPAMHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFT
FSVLSNLVQLNIANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLF
LSGNPWKCNCSFLDFAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHL
DHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKSSEEDEDEAGTRVEVSRRIFQ
TQTSSVQEFPQLI
Download sequence
Identical sequences G3QWK2 Q8N7C0
ENSP00000294818 ENSGGOP00000007162 ENSP00000294818 gi|194018474|ref|NP_001005214.2| NP_001005214.2.87134 NP_001005214.2.92137 XP_004027872.1.27298 XP_018881640.1.27298 ENSGGOP00000007162 9606.ENSP00000294818 ENSP00000294818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]