SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NBS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NBS9
Domain Number 1 Region: 186-294
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-33
Family PDI-like 0.0074
Further Details:      
 
Domain Number 2 Region: 320-427
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.53e-33
Family PDI-like 0.0044
Further Details:      
 
Domain Number 3 Region: 64-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.27e-30
Family PDI-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8NBS9
Sequence length 432
Comment (sp|Q8NBS9|TXND5_HUMAN) Thioredoxin-like protein p46 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TXNDC5; OC=Catarrhini; Hominidae; Homo.
Sequence
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL
Download sequence
Identical sequences Q8NBS9
ENSP00000369081 NP_110437.2.87134 NP_110437.2.92137 9606.ENSP00000369081 gi|42794771|ref|NP_110437.2| ENSP00000369081 ENSP00000369081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]