SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8P703 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8P703
Domain Number 1 Region: 36-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.16e-35
Family Carboxylesterase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8P703
Sequence length 264
Comment (tr|Q8P703|Q8P703_XANCP) Uncharacterized protein {ECO:0000313|EMBL:AAM42083.1} KW=Complete proteome; Reference proteome OX=190485 OS=NCPPB 528 / LMG 568 / P 25). GN=XCC2811 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MRCCLLLVVLALLLPGCSSLVDRHQDTRRGHFVTRSLEIEGRHYQYQVFVPVGTSPQPRP
IVLFLHGSGERGDNGRNQAEVGVGPYLSEHTADFPALVVLPQVPDDEEWLGINARMAIAA
LDATSAEFSADPQHTYLTGISMGGYGAWEIGLMQPQRFAAIVPICGALKAPRDERRTLYV
SLVAQEADPYTAAVTRLKHVPIWMFHGAKDEAVPPHDDRALYRAAKGVGANVRYSEYPNG
NHNAWDATYADPAMWEWMFKQRLR
Download sequence
Identical sequences A0A0H2X784 B0RQG4 Q8P703
190485.XCC2811 314565.XC_1302 509169.xccb100_1349 gi|188990745|ref|YP_001902755.1| gi|66767629|ref|YP_242391.1| NP_638159.1.47755 WP_011037937.1.10627 WP_011037937.1.16446 WP_011037937.1.1732 WP_011037937.1.18295 WP_011037937.1.22538 WP_011037937.1.27778 WP_011037937.1.36111 WP_011037937.1.43481 WP_011037937.1.4502 WP_011037937.1.475 WP_011037937.1.82601 WP_011037937.1.88278 gi|21232242|ref|NP_638159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]