SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8PTR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8PTR3
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.36e-61
Family Haloperoxidase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8PTR3
Sequence length 264
Comment (tr|Q8PTR3|Q8PTR3_METMA) Hydrolase {ECO:0000313|EMBL:AAM32346.1} KW=Complete proteome; Reference proteome OX=192952 OS=JCM 11833 / OCM 88) (Methanosarcina frisia). GN=MM_2650 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MDEVEINGLHIAFERKGEGSPLILLHGALSDSRMWRRQLDELSDEFTVVAWDAPGCGRST
DPPETFRLPDFADCLAAFIEEIGLVKPHILGLSFGAGLALEFYRRYSSIPKSLILASAYA
GWAGSLPPDVVEERLQQGLQQSRLPPQKVVEKWIPTLFTKSVPVEVINETATIMSEFHPA
GMRVILRSFAEADLRDMLPTIKVPTLLLYGEADQRSPLYVAEDLHARIPASKLVIIPGVG
HDCSLEAPEIFNAEVCSFLQANTK
Download sequence
Identical sequences Q8PTR3
WP_011034561.1.49674 gi|21228752|ref|NP_634674.1| 192952.MM_2650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]