SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8R1S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8R1S0
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-48
Family FAD-linked reductases, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8R1S0
Sequence length 476
Comment (sp|Q8R1S0|COQ6_MOUSE) Coenzyme Q10 monooxygenase 6 {ECO:0000255|HAMAP-Rule:MF_03193} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Coq6 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAARIGSMAGLLCVRWWSSAQLAARGGPLVASQRWAGSSADTVYDVVVSGGGLVGSAMAC
ALGHDIHFHDKKILLLEAGPKKALEKLSETYSNRVSSISPGSTTLLSSFGAWDHICNMRC
KAFRRMQVWDSCSEALIMFDRDNLDDMGYIVENDVIMYALTKQLEAVADRVKVLYESKAV
GYSWPGAFSMADSSPWVHITLGDGSTLQTKLLIGADGHKSGVRQAAGIQNVSWKYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEEFVDA
INSAFWSDVHHTDFVDSASAMVRHAVALLKPTKVSARQLPPSIAKVDAKSRALFPLGLGH
AAEYVRPRVALIGDAAHRIHPLAGQGVNMGFGDISSLVHHLSTAAFNGKDLGSMSHLTGY
ETDRQRHNTALLAATDLLKRLYSTSATPLVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences Q8R1S0
ENSMUSP00000021661 ENSMUSP00000021661 NP_766170.2.92730 XP_006515762.1.92730 10090.ENSMUSP00000105905 ENSMUSP00000021661 ENSMUSP00000105905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]