SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8R2L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8R2L5
Domain Number 1 Region: 52-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.58e-26
Family Ribosomal protein S18 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8R2L5
Sequence length 143
Comment (sp|Q8R2L5|RT18C_MOUSE) 28S ribosomal protein S18-1, mitochondrial KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mrps18c; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAALVALCSGIGRKNLTTAAGCFTDRGTQAVSVIWRRCFSQFEQVTSNEDLPVPMENPYK
EPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQREITKAIKRAQKMGF
MPVTYKDPAYLKDPRVCNIRYRE
Download sequence
Identical sequences Q8R2L5
ENSMUSP00000016977 ENSMUSP00000016977 10090.ENSMUSP00000016977 ENSMUSP00000016977 NP_081102.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]