SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8S2V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8S2V8
Domain Number 1 Region: 49-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.26e-38
Family PAPS reductase-like 0.0052
Further Details:      
 
Domain Number 2 Region: 303-410
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000104
Family PDI-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8S2V8
Sequence length 413
Comment (tr|Q8S2V8|Q8S2V8_CHLRE) 5'-adenylylsulfate reductase {ECO:0000313|EMBL:AAM18118.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN= OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MMLTQGRAFAAQRPAVQQRRMAVRANVARVPQVNAAAVEAKPDWAGLAAEMDNKSPLEIM
DHALKTFGNDVAIAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYQLFDAVEKHYK
IRIEYTFPEAQEVMDLVRAKGLYSFYEDGHTECCRIRKVKPLRKQLKVYKAWITGQRKDQ
SPGTRTEVPVVQVDPVFEGVTGGPGSLIKYNPLSNMTSAEVWNFLRVMKVPTNKLHNCGY
ISIGCEPCTRPVLPNQAEREGRWWWEDAAAKECGLHSGNIKKADGTTEERKAERDLWPAG
SAVATLSKDEVRALAAGERSQGTLAVLYAPWCPFCQAMEANFEELAKHMTGHKVRVAKYQ
ADIDREFCNENLQLKTFPTIVYLPPNSKQVIKYPSERRDVDTLSMWVKTVAGQ
Download sequence
Identical sequences Q8S2V8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]