SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8S718 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8S718
Domain Number 1 Region: 87-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 8-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.93e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8S718
Sequence length 241
Comment (tr|Q8S718|Q8S718_ORYSJ) cDNA clone:J013101K13, full insert sequence {ECO:0000313|EMBL:BAG90386.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_32243 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAGKDDDVKVLGLVMSPFAIRVCIALKLKGVSYEYIEEDLANKSELLLSSNPVHKKIPVL
IHGGKPVSESLVIVQYVDEAWAPSPTSPSILPADPYDRAVARFWAAYVDDKMVPGMVGVL
RAATEEERAAKADETLAAMAQLEKAFAEVAAKNGKPFFGGDTVGYVDLALGCNLHFLEAI
RRLHGVALVDAGKTPLLAAWAERFVEVEAAKGVVPDADDAVEFARKVQARVAAAAASTAA
K
Download sequence
Identical sequences A0A0D3HFW4 A0A0E0HIC8 A0A0E0R1Q4 A2Z9L8 Q8S718
LOC_Os10g38700.1|13110.m03525|protein XP_015614528.1.37577 LOC_Os10g38700.1|PACid:21885848 39946.BGIOSIBCE032855 39947.LOC_Os10g38700.1 ONIVA05G27510.1 OsIBCD031290 OBART10G16490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]