SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8S8E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8S8E7
Domain Number 1 Region: 7-166
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.52e-22
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8S8E7
Sequence length 218
Comment (tr|Q8S8E7|Q8S8E7_ARATH) Expressed protein {ECO:0000313|EMBL:AAM15335.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At2g04845 OC=Arabidopsis.
Sequence
MVTRMATKVSLEGKRVVLVPYMAEHVPKYHQWMQDSALLEATGSEPLSLEQEYEMQLSWT
QDPNKRTFIVLDKDFVKGDLAHGQPHVEAMTGDVNIYMNDVDDPKVAEVEIMIAEPRSRG
KGLGKESVLIMMAYGVKNLEIHKFTAKIGESNTASLSLFRKLGFEESSYSGIFKEVTLEY
PVTNLRREELLKLLDEVIRHTHSSNNPSDSLLSGEATA
Download sequence
Identical sequences Q8S8E7
AT2G04845.1 AT2G04845.1 NP_565315.1.80155 3702.AT2G04845.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]