SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8SPS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8SPS7
Domain Number 1 Region: 81-346
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-58
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 2 Region: 33-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000484
Family SCOPe 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8SPS7
Sequence length 347
Comment (sp|Q8SPS7|HPT_PIG) Haptoglobin beta chain KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=HP; OC=Sus.
Sequence
MRALGAVVALLLCGQLFAAETGNEATDATDDSCPKPPEIPKGYVEHMVRYHCQTYYKLRT
AGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGGSLDAKGSFPWQAKM
ISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFH
PDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYV
MLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAF
AVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIADN
Download sequence
Identical sequences Q8SPS7
ENSSSCP00000002967 NP_999165.1.46622 ENSSSCP00000002967 9823.ENSSSCP00000002967 4f4o_C 4f4o_F 4f4o_I 4f4o_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]