SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8SYD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8SYD0
Domain Number 1 Region: 233-356
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000245
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 2 Region: 109-254
Classification Level Classification E-value
Superfamily TPR-like 0.0000000725
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8SYD0
Sequence length 369
Comment (sp|Q8SYD0|TTC19_DROME) Tetratricopeptide repeat protein 19 homolog, mitochondrial KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Ttc19; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLVRNICKFTQVMGRFRVVVNPRDYCHLAPLKRSRYHQRSEFGCRPLCSNAAGYEVSWAA
PPASGSSGGMFWAFSAAFTLNLFGGADEKEETPEEKLIKTIKRSILCIQREQYDKAEQML
HLALRMAQDIQSKDGITYVFDLMANLAMEREQFKKAEKIFTDVMKRLFAEGHTEESPKIL
HISSKIAHMSQLQGDLEKSFQGFTWTLQQLAKLLEKMPDDKDILELYGLTKNWFGQLLMK
QGKYLEAKNLFKEAFDTLINVYGAVNDASVTILNNISVAYVNLEKYAEARETLLEAMELT
KELKDATQEGILQANLGLVYLREGLMSQAENACRLAWKLGKQHQNPDAVEQAEYCLNEIK
TTLNGEKRQ
Download sequence
Identical sequences Q8SYD0
FBpp0080720 FR688 FBpp0080720 FBpp0080720 7227.FBpp0080720 NP_609934.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]