SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TAV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8TAV0
Domain Number - Region: 6-74
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00711
Family Di-heme elbow motif 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8TAV0
Sequence length 307
Comment (sp|Q8TAV0|FA76A_HUMAN) Protein FAM76A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM76A; OC=Catarrhini; Hominidae; Homo.
Sequence
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQ
NVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVD
GKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMIL
EKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEK
SGAITSP
Download sequence
Identical sequences A0A0D9S822 A0A1D5QXM5 A0A2I2ZME3 A0A2K5EM01 A0A2K5M510 A0A2K5RKX5 A0A2K5UD72 A0A2K6B5C7 A0A2K6KW94 A0A2K6PST9 A0A2K6THT4 F7ICM2 H2N8C5 K7BZT0 Q8TAV0
ENSP00000363065 ENSP00000363065 ENSPPYP00000001914 ENSCJAP00000017156 ENSMMUP00000016060 gi|22749341|ref|NP_689873.1| NP_689873.1.87134 NP_689873.1.92137 XP_001111995.1.72884 XP_003921329.1.74449 XP_005544314.1.63531 XP_007978001.1.81039 XP_010378670.1.97406 XP_011761359.1.29376 XP_011935309.1.92194 XP_012295575.1.9421 XP_017390208.1.71028 XP_017711954.1.44346 XP_018872096.1.27298 XP_513248.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]