SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TCY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8TCY5
Domain Number - Region: 49-100
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0572
Family Cytochrome c3-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TCY5
Sequence length 172
Comment (sp|Q8TCY5|MRAP_HUMAN) Fat tissue-specific low MW protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MRAP; OC=Catarrhini; Hominidae; Homo.
Sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Download sequence
Identical sequences Q8TCY5
ENSP00000306697 ENSP00000382684 ENSP00000306697 ENSP00000382684 ENSP00000306697 gi|30520312|ref|NP_848932.1| 9606.ENSP00000306697 NP_848932.1.87134 NP_848932.1.92137 XP_006724091.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]