SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TDM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TDM5
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000342
Family Snake venom toxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8TDM5
Sequence length 124
Comment (sp|Q8TDM5|SACA4_HUMAN) Sperm acrosomal membrane-associated protein 14 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPACA4; OC=Catarrhini; Hominidae; Homo.
Sequence
MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPV
INKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLP
PRLL
Download sequence
Identical sequences A0A140VJU1 A0A2I3TN96 Q8TDM5
NP_598005.1.87134 NP_598005.1.92137 XP_001171475.1.37143 XP_003814134.1.60992 ENSP00000312774 gi|19424138|ref|NP_598005.1| ENSPTRP00000019288 ENSPTRP00000019288 9598.ENSPTRP00000019288 9606.ENSP00000312774 ENSP00000312774 ENSP00000312774 NYSGRC-19424138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]