SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TI49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TI49
Domain Number 1 Region: 22-75
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000116
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TI49
Sequence length 76
Comment (tr|Q8TI49|Q8TI49_METAC) EF hand family protein {ECO:0000313|EMBL:AAM07651.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_4307 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MTLLSPQPDQEYTPRDLDGEGFYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNG
NGRIDFDDVVRMFAMI
Download sequence
Identical sequences Q8TI49
gi|20093096|ref|NP_619171.1| WP_011024188.1.98848 188937.MA4307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]