SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TMB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8TMB7
Domain Number - Region: 45-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0374
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8TMB7
Sequence length 135
Comment (tr|Q8TMB7|Q8TMB7_METAC) Uncharacterized protein {ECO:0000313|EMBL:AAM06125.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_2747 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVGNRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINGNYSATDKKVC
FLSNAVILRLIAALH
Download sequence
Identical sequences Q8TMB7
188937.MA2747 gi|20091570|ref|NP_617645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]