SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TMC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8TMC5
Domain Number - Region: 45-89
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0699
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8TMC5
Sequence length 428
Comment (tr|Q8TMC5|Q8TMC5_METAC) Uncharacterized protein {ECO:0000313|EMBL:AAM06114.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_2735 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVENRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINVRYDGRCSLHN
SRRIGETYTEGVINVCGRAPCPTSLWLYEQKLAKLSKQELLNQGVSFEETLYVDGNWIKN
GWKKKLEEFIGTKLTKKEWKKMRYKSVYVVATKEKVILDFEVTERLPTIEALMPLFIRIK
NRFPEDKIKKIVSDEDKAIIGAVKMVFPEVTHSFCVFHQLKNVSKRYYEEFSSIEEIPDN
DKITYNEISQLILSDTVISAVAHIQKIREFNSDLELSEASHKAISYAEEIFSKNVSFLKK
GFTPETDNTMEQIFSLICDIVDKARSFKTDNGLTNFCYNLFTFFNKRCFSTGKWKGFSPL
MRARFQYG
Download sequence
Identical sequences Q8TMC5
WP_011022694.1.98848 188937.MA2735 gi|20091559|ref|NP_617634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]