SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TMH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TMH2
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily RING/U-box 5.53e-27
Family Zf-UBP 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8TMH2
Sequence length 86
Comment (tr|Q8TMH2|Q8TMH2_METAC) Uncharacterized protein {ECO:0000313|EMBL:AAM06063.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_4679 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MVCTHRDTIKVENFEPGEKGCEECLKSGDSWVHLRICLTCGHVGCCNQSKNKHATKHFEE
TGHPVIQSYQPGENWKYCYIDREYLK
Download sequence
Identical sequences Q8TMH2
gi|20091508|ref|NP_617583.1| WP_011022645.1.98848 188937.MA4679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]