SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TMP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8TMP3
Domain Number - Region: 87-142
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000691
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.045
Further Details:      
 
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily RING/U-box 0.00109
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8TMP3
Sequence length 211
Comment (tr|Q8TMP3|Q8TMP3_METAC) Uncharacterized protein {ECO:0000313|EMBL:AAM05991.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_2610 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MQQCPNCLTLVGKLHMRCIWCGLYFCEDCVNPHNHYCPAYKEGMEYSVDISRVYSIECYE
RFATSEDLEEENVSELSAEEKEVYSQEHIIKSNLIFQERLRLGVGEPPDRCPNCESTLNK
VDEKCDLCGIKFCASCVAPNKHNCVIAQYELEKNPTPVKPEVIVESSMEAEIIAESIVDS
EVSEPIKIDVPKERTEIRKVSFLRRLLHKFF
Download sequence
Identical sequences Q8TMP3
188937.MA2610 gi|20091436|ref|NP_617511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]