SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TPZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TPZ2
Domain Number 1 Region: 770-862
Classification Level Classification E-value
Superfamily PKD domain 3.14e-32
Family PKD domain 0.00023
Further Details:      
 
Domain Number 2 Region: 21-106
Classification Level Classification E-value
Superfamily PKD domain 1.31e-29
Family PKD domain 0.00011
Further Details:      
 
Domain Number 3 Region: 274-365
Classification Level Classification E-value
Superfamily PKD domain 2.88e-29
Family PKD domain 0.00026
Further Details:      
 
Domain Number 4 Region: 110-195
Classification Level Classification E-value
Superfamily PKD domain 1.57e-24
Family PKD domain 0.0004
Further Details:      
 
Domain Number 5 Region: 192-265
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000144
Family PKD domain 0.00081
Further Details:      
 
Weak hits

Sequence:  Q8TPZ2
Domain Number - Region: 1021-1072
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000667
Family Type I dockerin domain 0.0089
Further Details:      
 
Domain Number - Region: 877-1000
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00157
Family Cellulose-binding domain family III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TPZ2
Sequence length 1075
Comment (tr|Q8TPZ2|Q8TPZ2_METAC) Surface antigen protein {ECO:0000313|EMBL:AAM05167.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_1761 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKRIFLILCIAALMCMTGLASAVVETVEPVANFTANTTSGPAPLTVQFTDISTNATGWAW
DFGDGNNSTEQNPVHTYSTEGTYTVSLTVSNAGGSDSEVKTEYISVSEPLPLAPVANFSA
DITSGVGPLTVHFTDSSSGSPDTWEWDFDNDGDVDSTEQNPQFIYTGEGTYSVKLTVTSS
AGSDSELKTDHITVVYPSPDFTANVTEGTVPLTVEFTGNVSGLAPEYWNMWAWDVDGDGT
YDYSPNFNITHTYTEPGTYDVIVAYDGWTQNVKAGYITVLPEIPVANFSADVTSGMEPLT
VNFTDQSTGTVSSYSWDFDNDGTVDSTEQNPSHTYTSAGNYTVNLTVSNAGGSDSELKTD
YITVTQAGQVATNDLRISGLVNTVPASAVFARETNPVKVLNVQNTGTATLSNISIAVYAS
DVSSGTVPVDTTTIASLEGDAKTTVTLIDPTIRDLEGGTVTYTAVVDPDNLIAETDETNN
NKSSAAKNVRYNGYKGKGIYWEGGSNITTKHTFDLQGNLLYSTQPDSAYQPVGWESRTET
WTASDLPVPDGSTIEKAFLYVAYNWDQTPGGYPWLNINFNGNTLDNGNISTGNGTIYRDW
SNFGAYANYEYGLCVYDVTDKFSSAGNSLVMTPVGENKNALYPSTLVVVYGNDNETRKQI
FINEECDELGLSASSYGTTPEEATAYAPFTGMSIDVEKVTNAMLYSFAGSAGPDEGNLLF
NGNIVATNAWQGSSNSGSPLVFDATNYINVTGNEAGIQSTTSGGMDALQQILVVEYEESA
PAAPIADFTATPTSGDAPLAVNFTDTSTGSPTSWSWDFGDGANSTAQNPLHTYSAEGNYT
VNLTVENDAGSDFELKTDYIAVSEASGSTVTLYFDPESSSVSENESTEISVVASNFPSGL
SGYNLTVTLDDPVVAEIVDIEYPSWALITENSTLPGTSIYLKTVDENNTVKADAADVVLA
TLTVSGKESGSSNLSIGIKRLDDDSGDSIEPTPLAGTIEVTLLSPLPDQEYAPKDLDGDG
LYEDLTGNGEFSFVDVVAYFHNMDWIEANMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TPZ2
188937.MA1761 WP_011021764.1.98848 MvR188 NYSGXRC-10384r gi|20090612|ref|NP_616687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]