SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TTL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TTL8
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000165
Family Galacturonase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TTL8
Sequence length 226
Comment (tr|Q8TTL8|Q8TTL8_METAC) Uncharacterized protein {ECO:0000313|EMBL:AAM03860.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_0412 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MTIKESHMEGIKAVRECEDVTIENCNIQSSEFGWLSHRMIIKNTELESEYPFFYSSDILL
DNFILNGKYSFQYVKNVEIRDSCLDTKDAFWHSKNVTVSNSIVKGEYLGWYSENLKLIRC
KIIGTQPLCYAKGLILEDCEMIGCDLAFEYSEVHAVITGSITSVKNPCSGHISADSIGEV
ILDENQPVDVSCVIEGRSELNKEEIQNSDNCNGNLFNNKDFPVQET
Download sequence
Identical sequences Q8TTL8
188937.MA0412 gi|20089305|ref|NP_615380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]