SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8U3I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8U3I6
Domain Number 1 Region: 8-256
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.15e-49
Family Haloperoxidase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8U3I6
Sequence length 257
Comment (tr|Q8U3I6|Q8U3I6_PYRFU) Lysophospholipase {ECO:0000313|EMBL:AAL80604.1} KW=Complete proteome; Reference proteome OX=186497 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1). GN=PF0480 OC=Pyrococcus.
Sequence
MTQVYKAKFGTPNRGWVIIVHGLGEHSGRYSKLVSMLVNEGYAVYTFDWPGHGKSPGKRG
HTSVEEAMEIIDFIIEEINDKPFLFGHSLGGLTVIRYAETRPEKIRGVIASSPALAKSPK
TPSFMVALAKILGVLLPSLTLSNGIDPNLLSRNPDAVKRYIEDPLVHDRISAKLGRSIFK
NMDLAHREAHKIKVPVLLLVGTGDVITPPEGARKLYGEIKVEDKEIVEFEGAYHEIFEDP
EWGEEFHKKIVEWIKKH
Download sequence
Identical sequences I6TVC6 Q8U3I6
186497.PF0480 gi|18976852|ref|NP_578209.1| APC60917 Pfu-497362-001 WP_011011597.1.13913 WP_011011597.1.59273 gi|397650985|ref|YP_006491566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]