SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8U3M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8U3M9
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-40
Family AlaX-like 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8U3M9
Sequence length 149
Comment (tr|Q8U3M9|Q8U3M9_PYRFU) Partial alanyl-tRNA synthetase matches COOH terminus {ECO:0000313|EMBL:AAL80552.1} KW=Complete proteome; Reference proteome OX=186497 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1). GN=PF0428 OC=Pyrococcus.
Sequence
MIEIRTHTALHVLKGAVVKVLGEGAKWTASVYVNGNHGRLTVKFNRKPTHEEIREIERLA
NEKIKENVPIQIYELSREEAEKIFGDEMYDLFPVPEHVRTLKVVVIEDWNVNACNKEHTK
TTGEIGEIKIRKVRFRKSKELLEISFDVL
Download sequence
Identical sequences I6UN86 Q8U3M9
Pfu-435947-001 gi|397650927|ref|YP_006491508.1| WP_011011542.1.13913 WP_011011542.1.59273 gi|18976800|ref|NP_578157.1| 186497.PF0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]