SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8VEL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8VEL2
Domain Number 1 Region: 52-148,182-433
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-54
Family Myotubularin-like phosphatases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8VEL2
Sequence length 648
Comment (sp|Q8VEL2|MTMRE_MOUSE) mJumpy KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mtmr14; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAGARAAAAASAGSTASSGSPPPQEPGLWELLEEFSRTQYRAKDSGGKSGSKVERIEKRC
LELFGRDYCFSVIPNVNGDICGHYPRHIVFLEYESSEKEKDTFQSTVQVNKLQDLIHRSK
MARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYLFSGGADDTWASTEDVTEED
FVLRSGDTHLFDKVRGYDIKLLQYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYAN
FTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLNIPNFLTQSLNIDWSQYQSW
DLVQQTQNYLKLLLFIMNRDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKPA
EILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFCLKTQRRKSLPTRDAG
FTVEDICMLRHKDRGSTTSLGSDFSLVLEHSPGAVGSFSYETVELAPAGAPTQAAWRKSH
SSSPQSMLWSRPQPSEERLPSHHGLTEAKSSSSSSSNHSDNFFRMGSSPLEVPKPRSVDH
PLPGSSLSTDFGSWQLVSGCGSIQDRPVLHTDSSLPFSFQDELPNSCLLTALSDRETRLQ
EVRSAFLAAYSSTVGLRAATPSPSGAIGGLLEQFARGVGLRGTSTSTL
Download sequence
Identical sequences Q8VEL2
ENSMUSP00000108771 10090.ENSMUSP00000108771 NP_081125.2.92730 ENSMUSP00000108771 ENSMUSP00000108771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]