SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8W3F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8W3F1
Domain Number 1 Region: 4-309
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.7e-53
Family Epoxide hydrolase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8W3F1
Sequence length 311
Comment (tr|Q8W3F1|Q8W3F1_ORYSJ) cDNA clone:J023096B06, full insert sequence {ECO:0000313|EMBL:BAG92510.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_32040 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MDQRIEHSYLPIRGLKLHIAHIGKGEAATLLFVHGFPEVWYSWRHQMIAAAAAGFRAIAL
DFPGYGLSEPPADLTQASWQGLMNDLLAILDSLSIPKVFLVAKDFGVKPAYDLALCHPDR
VCGIVSLGVPPLVESLSFSGLPEGFYIHRWREPGRAEADFGRFDTRRILRTIYILFSRSE
IPVAKQGQEIMDLADESTPMPQWFTEEDLSAYTDLYEKSGLMTAIQIPYRTKAAKAEGAN
PRFEMPMFVIMGQKDYILKFPALKEYMSSEKLKEIAPDYGITYIPEGSHFVQEQFPDLVN
QLVIDFVSKHA
Download sequence
Identical sequences A0A0E0EZH8 A0A0E0IUP9 A0A0E0R0Y4 Q8W3F1
OMERI10G11230.1 ONIVA10G16440.1 LOC_Os10g35490.1|13110.m03187|protein LOC_Os10g35490.1|PACid:21886514 XP_015612761.1.37577 39947.LOC_Os10g35490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]