SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8WSM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WSM7
Domain Number 1 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000567
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8WSM7
Sequence length 210
Comment (tr|Q8WSM7|Q8WSM7_PLACH) Merozoite surface protein 4/5 {ECO:0000313|EMBL:AAL61862.1} OX=31271 OS=Plasmodium chabaudi chabaudi. GN=MSP4/5 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKIANYLSAINLFVVLLMSFKNAHDTSLINTNKCAHNMVGNNRILGNIPSDNTEDSSNQV
EGNADSNEVTSEEAKNTSNQGNGENANQAGTPAEPAKADATQNAAAQPDNTNGTGSKTTD
ANVTLLSSEEDDEEEDDDTEYEEGNCEVNNGGCGPNLKCEKMPNGAIKCSCPSGFKLQGT
DCIALFSADSVNYSFCGIIMVAIAIIALLY
Download sequence
Identical sequences Q8WSM7
gi|18152808|gb|AAL61862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]