SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8WWM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WWM9
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 2.17e-43
Family Globins 0.0000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8WWM9
Sequence length 190
Comment (sp|Q8WWM9|CYGB_HUMAN) Stellate cell activation-associated protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CYGB; OC=Catarrhini; Hominidae; Homo.
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences A0A1K0FUB6 K7AH89 Q8WWM9
ENSP00000293230 ENSP00000293230 9606.ENSP00000293230 NP_599030.1.87134 NP_599030.1.92137 XP_003953243.2.37143 gi|19549331|ref|NP_599030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]