SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8YKX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YKX3
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-21
Family Beta-D-xylosidase C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8YKX3
Sequence length 183
Comment (tr|Q8YKX3|Q8YKX3_NOSS1) All7165 protein {ECO:0000313|EMBL:BAB78249.1} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all7165 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MEWLNEPPNWSHSDQKIIVTTSPKTDFWRITHYGFIRDSGHFYFDRVSTDFVVDVKIKGN
YKDLYDQAGIMIRADEQHWIKTGIEYVDGVQNLSAVVTHNYSDWSFTPLLNPPNIFQVRV
ERCQEAIHIAYLDEYSRYVPFRMAYFPVALDIQVGIMCASPQGNGYEVIFEDYQLTKKGE
KLS
Download sequence
Identical sequences Q8YKX3
gi|17233181|ref|NP_490271.1| 103690.all7165 gi|17233181|ref|NP_490271.1|NC_003276 WP_010999722.1.33676 NsR24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]