SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8YL21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8YL21
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00153
Family Intron-encoded homing endonucleases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8YL21
Sequence length 102
Comment (tr|Q8YL21|Q8YL21_NOSS1) All7117 protein {ECO:0000313|EMBL:BAB78201.1} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all7117 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MIQGKYPDNWKQLATALKAASNWRCSKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHRFGRGNVSPGQLSLFAEQKVS
Download sequence
Identical sequences A0A1Z4KUJ5 Q8YL21
NsR198 gi|17233133|ref|NP_490223.1|NC_003276 WP_010999674.1.33676 gi|17233133|ref|NP_490223.1| 103690.all7117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]