SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8YM30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YM30
Domain Number 1 Region: 21-348
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.71e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.018
Further Details:      
 
Domain Number 2 Region: 534-705
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000471
Family iota-carrageenase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8YM30
Sequence length 962
Comment (tr|Q8YM30|Q8YM30_NOSS1) All5111 protein {ECO:0000313|EMBL:BAB76810.1} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all5111 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MMKVSSVGLVLLNQLSLGFMLIWCHTAHAQVTSDGTTNTIVNPSGNNFHILDGIEKGNNL
FHSFSNFSVPTGGSATFDVTNTPNITTIFSRVTGGNISQIDGLIQTLGGNHQVSLFLMNP
NGIMFGQNAKLDIGGSFVGTTANSIKFTDGTEFSAINPISPPLLTMSVPIGLQMGSSASS
ITVQARPLQVDTGQSLVLLGGDIDLNGTGNARLLARDGQVILGSVASENFVPFSFSNARF
NFDFSGIPTFQTVQLRNGFTVDVNGSRGGNIQIHGQQVNITGNSQLMANSTGKTADGEGV
VVRASDALNIINSEIRVRLTADAQGRGGNITLAAPVMQITGNSNIATNLRGNETFGTLGL
DKGSNITITSQDFLLLGNATSRTGNGSARITTQGQGGVGRVGDIRITADRVRLLNNARVI
TDVTSTPVGGKAQAGDVVVNAGDVEISGSSSSQINSWISSTLERETSGWGGNIEINASRS
VRLSDSGTIRADSFGNGNASNITIRTPDLEIVGTNGLSRQSRISSSTAIFAAAPGFQAGD
IQIETQRLRLLDGGSLLVSSETKSSSGSINIKATESVEVIGAALDDRGGWRISGIDASSR
GEPLPNGDPGDISRINITTDTLRVLNSGAIKSSVTGDRIGGDISINAHTIEVGGRAVHSE
TMPTSQISSAASNPLTPGAGIAGNISLTTNRLFVRDGGLISVSGQDQAQAGNLQITAAQS
INLAQNSSLSAVSSVGDGGNINIDLNSSGLLYLRDMSQISTEAEGNGNGGNININHALFV
LGLENSDIVANAFQGRGGNINITTQGIIGLEFRNTLTPREDITNDITASSQFSVNGTVQI
NNVGIDPNSGVVELPTNVSDPSQQIANACDSNQGSSFIATGRGGIPQNPMQEVRSDRTWS
DTRDISAFQNTPQIQAQTPIQPQIPIQATSWHRNTQGKIELIADKSSVNLQPSLTCAAVN
KS
Download sequence
Identical sequences Q8YM30
gi|17232603|ref|NP_489151.1| 103690.all5111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]