SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8YM33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YM33
Domain Number 1 Region: 2-272
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.69e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 347-426,458-488
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000722
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 247-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8YM33
Sequence length 733
Comment (tr|Q8YM33|Q8YM33_NOSS1) All5108 protein {ECO:0000313|EMBL:BAB76807.1} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all5108 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTGSSISHIDGLIQANGSANLFLLNPNGIIFGSNARLNIGGSFLGTTADSINFSDGFIFS
TTDTTTPSLLTMSVPIGLQMGQNSGSIQVQGQGHNLLHPTNFLAPVTRDPQLGGLRLFPG
KTLALLGNGIQLDAGVLIAESGHIELGSMTAGTVHLNTNTPIWKFDYHSGQILSDIYLTR
AALIDTSGNPGGSIHLQGKDIHIQNSSSVFIQHQGQQRPGSIKINADLLAMSGALPQKNP
SFILSENLGSGYGANIDVSARQLIVQDGGGILSTTYTNGGKGGDITVTAAESIQIIGFSP
INFRASGINSPSFPGGGKGGNISIATRDLIVKEGGTITSLVEGGGSGGNIHMTADIISLF
GENPGSGGASAIATSTFFGGDGGVITINTRQLILRASGVISASTSDTGNAGDLTIYASES
VEVDGSNSVLRDHSRITASGQRFRPRYLQNRGLSAFPSGNGGNLTIISPTIKVSNEGYIA
AENIGSGNGGYLQIQTDSLLLEQQGQIRTAAASGQGGSLGLIVGDILLMRHNSLISARAG
NNGNGGNITVISPLIVGLENSDIIANAVAGNGGKIQITTQGLLGLEFRDGETSESDITAS
SQFGVSGTVQINNVGVDPNSGLVELPENVTDPSQQIATGCSNTNSSSFVATGRGGVPQNP
TQEVRSDRTWSDTRDISAFQNTPQIQAQTPIQPQIPIQATSWHRNTQGKIELIADKSSVN
LQSSLTCTAFHKG
Download sequence
Identical sequences Q8YM33
gi|17232600|ref|NP_489148.1| 103690.all5108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]