SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8YZX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YZX3
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000275
Family Serralysin-like metalloprotease, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8YZX3
Sequence length 122
Comment (tr|Q8YZX3|Q8YZX3_NOSS1) All0332 protein {ECO:0000313|EMBL:BAB72290.1} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all0332 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTGGTESDRFLYSSGRAFTSNDFGIDILTDFTSGIDKLVLSKNTFRALTSVVGDGLSQVS
DFTTVEDDDLAATSTAFLVYSIGSGSLYYNQNGSAAGFGTGAELANLINLPSLTAADLAI
VA
Download sequence
Identical sequences A0A1Z4KQP3 Q8YZX3
103690.all0332 WP_010994508.1.33676 gi|17227828|ref|NP_484376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]