SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q91WB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q91WB7
Domain Number 1 Region: 129-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.53e-20
Family Ubiquitin-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q91WB7
Sequence length 227
Comment (sp|Q91WB7|UBTD1_MOUSE) Ubiquitin domain-containing protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ubtd1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLNASLPDTVGQLKRQLHS
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Download sequence
Identical sequences Q91WB7
ENSMUSP00000026170 10090.ENSMUSP00000026170 ENSMUSP00000026170 ENSMUSP00000026170 MmR40 NP_663475.1.92730 XP_021064176.1.100879 XP_021517082.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]