SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q921G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q921G7
Domain Number 1 Region: 39-268,367-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-65
Family FAD-linked reductases, N-terminal domain 0.00000000000533
Further Details:      
 
Domain Number 2 Region: 269-367
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.65e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.000000876
Further Details:      
 
Domain Number 3 Region: 515-614
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.01e-29
Family ETF-QO domain-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q921G7
Sequence length 616
Comment (sp|Q921G7|ETFD_MOUSE) Electron-transferring-flavoprotein dehydrogenase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Etfdh; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLVRLTKLSCPAYHWFHALKIKKCLPLCAPRCSSTSAVPQITTHYTVHPREKDKRWEGVN
MERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDIRVCLVEKAAQIGAHTLSGACLDP
AAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIPVPILPGLPMNNHGNYIVRLGHLVS
WMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKV
TVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGLKELWIIDEKKWKPGRVDHTVGWPLDR
HTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIAY
GARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGSLAAESIFKQLTSE
NLQSKTTGLHVTEYEDNLKQSWVWKELHAVRNIRPSCHGILGVYGGMIYTGIFYWILRGM
EPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKD
DSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNI
NWVVPEGGGGPAYNGM
Download sequence
Identical sequences Q921G7
NP_080070.2.92730 10090.ENSMUSP00000029386 ENSMUSP00000029386 ENSMUSP00000029386 ENSMUSP00000029386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]