SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q922Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q922Z5
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000146
Family Ccg1/TafII250-interacting factor B (Cib) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q922Z5
Sequence length 150
Comment (tr|Q922Z5|Q922Z5_MOUSE) Abhd5 protein {ECO:0000313|EMBL:AAH06683.1} OX=10090 OS=Mus musculus (Mouse). GN=Abhd5 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
ALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSG
ETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKT
IAILGAGHYVYADQPEEFNQKVKEICHTVD
Download sequence
Identical sequences Q922Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]