SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q92858 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92858
Domain Number 1 Region: 157-219
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.23e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q92858
Sequence length 354
Comment (sp|Q92858|ATOH1_HUMAN) Helix-loop-helix protein hATH-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ATOH1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTD
PRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPG
PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFD
QLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRT
AASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS
ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Download sequence
Identical sequences Q92858
9606.ENSP00000302216 gi|4885075|ref|NP_005163.1| ENSP00000302216 ENSP00000302216 NP_005163.1.87134 NP_005163.1.92137 ENSP00000302216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]