SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q92886 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92886
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q92886
Sequence length 237
Comment (sp|Q92886|NGN1_HUMAN) Neurogenic differentiation factor 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NEUROG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH
Download sequence
Identical sequences F1T0H3 Q92886
gi|38455396|ref|NP_006152.2| ENSP00000317580 ENSP00000317580 NP_006152.2.87134 NP_006152.2.92137 9606.ENSP00000317580 HR6466 ENSP00000317580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]