SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q92F12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92F12
Domain Number 1 Region: 27-87,120-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000012
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92F12
Sequence length 208
Comment (tr|Q92F12|Q92F12_LISIN) Lin0296 protein {ECO:0000313|EMBL:CAC95529.1} KW=Complete proteome OX=272626 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262). GN=lin0296 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MMADLQDRLARIQAKITALKEKDPDLNLFGSESHAYKLNEPLSNQTLTTFENEHQITLPP
DYRAFLELIGNGGMGPYYGLETLEDGLCSSLDYKDKKYGVQTLSEPFPHTDDWIAPGYKE
GMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPSYGEIWVDDRNNDNGVYP
DFYFGNEERLGFLEWYEVWLDKSIEEFE
Download sequence
Identical sequences H1GA72 Q92F12
272626.lin0296 gi|16799373|ref|NP_469641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]