SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q93WY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q93WY5
Domain Number 1 Region: 78-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.09e-41
Family Glutathione S-transferase (GST), C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.81e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q93WY5
Sequence length 223
Comment (tr|Q93WY5|Q93WY5_ORYSJ) cDNA clone:J013026J15, full insert sequence {ECO:0000313|EMBL:BAG94156.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OJ1005_D12.39 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV
HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG
EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGVEVVTD
EALPLMKAWFDRVLAVDAVKAVLPPRDKLVALNKARREQILSA
Download sequence
Identical sequences A2Z263 Q93WY5
OsIBCD028842 LOC_Os09g29200.1|PACid:21926090 LOC_Os09g29200.1|13109.m02893|protein XP_015611712.1.37577 39946.BGIOSIBCE030259 39947.LOC_Os09g29200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]