SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95230 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95230
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000141
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q95230
Sequence length 163
Comment (sp|Q95230|SP17_PAPHA) Sperm autoantigenic protein 17 OX=9557 OS=Papio hamadryas (Hamadryas baboon). GN=SPA17; OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQVSGKEEETSVTILDSSEEDKEKEEVAAVK
IQAAFRGHVAREEVKKMKTDSLQNEEKEENSEDTGFTSRTHEK
Download sequence
Identical sequences A0A096MPS2 Q95230
ENSPANP00000001734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]