SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95RE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95RE4
Domain Number 1 Region: 58-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.88e-21
Family Cold shock DNA-binding domain-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q95RE4
Sequence length 352
Comment (tr|Q95RE4|Q95RE4_DROME) Ypsilon schachtel, isoform A {ECO:0000313|EMBL:AAF49961.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5654 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIAT
KVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGE
KGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAA
PIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQP
RRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRD
GGEYIQGQGPPRPQQPRPRRQRKPNGPGGGSEQQPEKNGAQELQNTTTESTA
Download sequence
Identical sequences Q95RE4
7227.FBpp0075759 FBpp0075759 NP_524033.2.81976 FBpp0075759 FBpp0075759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]